Lineage for d1tdha3 (1tdh A:247-290)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035992Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 3036046Protein Endonuclease VIII-like 1 (NEIL1) [111443] (1 species)
  7. 3036047Species Human (Homo sapiens) [TaxId:9606] [111444] (1 PDB entry)
    Uniprot Q96FI4 1-333
  8. 3036048Domain d1tdha3: 1tdh A:247-290 [106774]
    Other proteins in same PDB: d1tdha1, d1tdha2
    complexed with trs

Details for d1tdha3

PDB Entry: 1tdh (more details), 2.1 Å

PDB Description: Crystal structure of human endonuclease VIII-like 1 (NEIL1)
PDB Compounds: (A:) nei endonuclease VIII-like 1

SCOPe Domain Sequences for d1tdha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdha3 g.39.1.8 (A:247-290) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]}
esgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap

SCOPe Domain Coordinates for d1tdha3:

Click to download the PDB-style file with coordinates for d1tdha3.
(The format of our PDB-style files is described here.)

Timeline for d1tdha3: