Class g: Small proteins [56992] (100 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
Protein Endonuclease VIII-like 1 (NEIL1) [111443] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111444] (1 PDB entry) Uniprot Q96FI4 1-333 |
Domain d1tdha3: 1tdh A:247-290 [106774] Other proteins in same PDB: d1tdha1, d1tdha2 complexed with trs |
PDB Entry: 1tdh (more details), 2.1 Å
SCOPe Domain Sequences for d1tdha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdha3 g.39.1.8 (A:247-290) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]} esgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap
Timeline for d1tdha3: