Lineage for d1tdha2 (1tdh A:2-131)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430477Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2430478Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) (S)
    automatically mapped to Pfam PF01149
  5. 2430479Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2430533Protein Endonuclease VIII-like 1 (NEIL1) [110335] (1 species)
  7. 2430534Species Human (Homo sapiens) [TaxId:9606] [110336] (1 PDB entry)
    Uniprot Q96FI4 1-333
  8. 2430535Domain d1tdha2: 1tdh A:2-131 [106773]
    Other proteins in same PDB: d1tdha1, d1tdha3
    complexed with trs

Details for d1tdha2

PDB Entry: 1tdh (more details), 2.1 Å

PDB Description: Crystal structure of human endonuclease VIII-like 1 (NEIL1)
PDB Compounds: (A:) nei endonuclease VIII-like 1

SCOPe Domain Sequences for d1tdha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdha2 b.113.1.1 (A:2-131) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]}
pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
rwdlggkwqp

SCOPe Domain Coordinates for d1tdha2:

Click to download the PDB-style file with coordinates for d1tdha2.
(The format of our PDB-style files is described here.)

Timeline for d1tdha2: