Class a: All alpha proteins [46456] (226 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
Protein Endonuclease VIII-like 1 (NEIL1) [109740] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109741] (1 PDB entry) |
Domain d1tdha1: 1tdh A:132-246 [106772] Other proteins in same PDB: d1tdha2, d1tdha3 complexed with tmn |
PDB Entry: 1tdh (more details), 2.1 Å
SCOP Domain Sequences for d1tdha1:
Sequence, based on SEQRES records: (download)
>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens)} grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf ekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlggrgygs
>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens)} grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf ekarsvlealqpeltlsqkirtklqnpdllelchsvpkevvqlggrgygs
Timeline for d1tdha1: