Lineage for d1tdha1 (1tdh A:132-246)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013619Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2013620Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2013695Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 protein domains)
    contains 4 helices in the core
  6. 2013749Protein Endonuclease VIII-like 1 (NEIL1) [109740] (1 species)
  7. 2013750Species Human (Homo sapiens) [TaxId:9606] [109741] (1 PDB entry)
    Uniprot Q96FI4 1-333
  8. 2013751Domain d1tdha1: 1tdh A:132-246 [106772]
    Other proteins in same PDB: d1tdha2, d1tdha3
    complexed with trs

Details for d1tdha1

PDB Entry: 1tdh (more details), 2.1 Å

PDB Description: Crystal structure of human endonuclease VIII-like 1 (NEIL1)
PDB Compounds: (A:) nei endonuclease VIII-like 1

SCOPe Domain Sequences for d1tdha1:

Sequence, based on SEQRES records: (download)

>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlggrgygs

Sequence, based on observed residues (ATOM records): (download)

>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqpeltlsqkirtklqnpdllelchsvpkevvqlggrgygs

SCOPe Domain Coordinates for d1tdha1:

Click to download the PDB-style file with coordinates for d1tdha1.
(The format of our PDB-style files is described here.)

Timeline for d1tdha1: