Lineage for d1td5c1 (1td5 C:4-179)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576707Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2576773Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
    Pfam PF01614
  6. 2576780Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)
  7. 2576781Species Escherichia coli [TaxId:562] [111112] (3 PDB entries)
    Uniprot P16528 98-272
  8. 2576792Domain d1td5c1: 1td5 C:4-179 [106769]
    Other proteins in same PDB: d1td5a2, d1td5b2, d1td5c2, d1td5d2
    Structural genomics target

Details for d1td5c1

PDB Entry: 1td5 (more details), 2.3 Å

PDB Description: Crystal Structure of the Ligand Binding Domain of E. coli IclR.
PDB Compounds: (C:) Acetate operon repressor

SCOPe Domain Sequences for d1td5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td5c1 d.110.2.2 (C:4-179) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]}
srnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggklpmh
asgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfddeeha
lglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm

SCOPe Domain Coordinates for d1td5c1:

Click to download the PDB-style file with coordinates for d1td5c1.
(The format of our PDB-style files is described here.)

Timeline for d1td5c1: