SCOPe 2.08: Domain d1td5c1: 1td5 C:4-179

Lineage for d1td5c1 (1td5 C:4-179)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
   Pfam PF01614

6. Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)

7. Species Escherichia coli [TaxId:562] [111112] (3 PDB entries)
   Uniprot P16528 98-272

8. Domain d1td5c1: 1td5 C:4-179 [106769]
   Other proteins in same PDB: d1td5a2, d1td5b2, d1td5c2, d1td5d2
   Structural genomics target

Details for d1td5c1

PDB Entry: 1td5, 2.3 Å

PDB Description: Crystal Structure of the Ligand Binding Domain of E. coli IclR.

PDB Compounds: (C:) Acetate operon repressor

SCOPe Domain Sequences for d1td5c1:

Sequence; same for both SEQRES and ATOM records:

>d1td5c1 d.110.2.2 (C:4-179) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]}
srnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggklpmh
asgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfddeeha
lglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm

Timeline for d1td5c1:

• d1td5c1 first appeared in SCOP 1.69, called d1td5c_
  
• d1td5c1 appears in SCOPe 2.07