SCOP 1.69: Domain d1td5b_: 1td5 B:

Lineage for d1td5b_ (1td5 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (3 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.2: IclR ligand-binding domain-like (Pfam 01614) [75513] (2 proteins)

6. Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)

7. Species Escherichia coli [TaxId:562] [111112] (1 PDB entry)

8. Domain d1td5b_: 1td5 B: [106768]

Details for d1td5b_

PDB Entry: 1td5, 2.3 Å

PDB Description: Crystal Structure of the Ligand Binding Domain of E. coli IclR.

SCOP Domain Sequences for d1td5b_:

Sequence; same for both SEQRES and ATOM records:

>d1td5b_ d.110.2.2 (B:) Transcriptional regulator IclR, C-terminal domain {Escherichia coli}
ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm

Timeline for d1td5b_:

• d1td5b_ is new in SCOP 1.69
  
• d1td5b_ appears in SCOP 1.71
  
• d1td5b_ appears in the current release, SCOPe 2.08, called d1td5b1