Lineage for d1td5b_ (1td5 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509664Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 509706Superfamily d.110.2: GAF domain-like [55781] (3 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 509720Family d.110.2.2: IclR ligand-binding domain-like (Pfam 01614) [75513] (2 proteins)
  6. 509727Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)
  7. 509728Species Escherichia coli [TaxId:562] [111112] (1 PDB entry)
  8. 509730Domain d1td5b_: 1td5 B: [106768]

Details for d1td5b_

PDB Entry: 1td5 (more details), 2.3 Å

PDB Description: Crystal Structure of the Ligand Binding Domain of E. coli IclR.

SCOP Domain Sequences for d1td5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td5b_ d.110.2.2 (B:) Transcriptional regulator IclR, C-terminal domain {Escherichia coli}
ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm

SCOP Domain Coordinates for d1td5b_:

Click to download the PDB-style file with coordinates for d1td5b_.
(The format of our PDB-style files is described here.)

Timeline for d1td5b_: