![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins) Pfam PF01614 |
![]() | Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [111112] (3 PDB entries) Uniprot P16528 98-272 |
![]() | Domain d1td5b1: 1td5 B:4-179 [106768] Other proteins in same PDB: d1td5a2, d1td5b2, d1td5c2, d1td5d2 Structural genomics target |
PDB Entry: 1td5 (more details), 2.3 Å
SCOPe Domain Sequences for d1td5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1td5b1 d.110.2.2 (B:4-179) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]} srnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggklpmh asgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfddeeha lglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm
Timeline for d1td5b1: