Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.2: Head decoration protein D (gpD, major capsid protein D) [51274] (1 family) automatically mapped to Pfam PF02924 |
Family b.85.2.1: Head decoration protein D (gpD, major capsid protein D) [51275] (2 proteins) |
Protein Head decoration protein D (gpD, major capsid protein D) [51276] (2 species) |
Species Bacteriophage lambda [TaxId:10710] [51277] (2 PDB entries) Uniprot P03712 |
Domain d1tcze_: 1tcz E: [106763] |
PDB Entry: 1tcz (more details), 1.85 Å
SCOPe Domain Sequences for d1tcze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcze_ b.85.2.1 (E:) Head decoration protein D (gpD, major capsid protein D) {Bacteriophage lambda [TaxId: 10710]} sdpahtatapgglsakapamtplmldtssrklvawdgttdgaavgilavaadqtsttltf yksgtfryedvlwpeaasdetkkrtafagtaisiv
Timeline for d1tcze_: