Lineage for d1tc6a_ (1tc6 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537079Protein HSP90 [55876] (3 species)
  7. 2537121Species Dog (Canis familiaris) [TaxId:9615] [103225] (34 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. 2537133Domain d1tc6a_: 1tc6 A: [106756]
    complexed with adp, mg, pg4

Details for d1tc6a_

PDB Entry: 1tc6 (more details), 1.87 Å

PDB Description: ligand induced conformational shift in the n-terminal domain of grp94, open conformation adp-complex
PDB Compounds: (A:) Endoplasmin

SCOPe Domain Sequences for d1tc6a_:

Sequence, based on SEQRES records: (download)

>d1tc6a_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
fafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneeltvk
ikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseligqf
gvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeea
sdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d1tc6a_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
fafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneeltvk
ikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseligqf
gvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeea
sdyleldtiknlvkkysqfinfpiyvwssktgktvwdwelmn

SCOPe Domain Coordinates for d1tc6a_:

Click to download the PDB-style file with coordinates for d1tc6a_.
(The format of our PDB-style files is described here.)

Timeline for d1tc6a_: