Lineage for d1tc5b1 (1tc5 B:10-194)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168191Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2168192Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2168193Family c.110.1.1: DTD-like [69501] (2 proteins)
    Pfam PF02580
  6. 2168202Protein probable eukaryotic D-amino acid tRNA deacylase [110589] (1 species)
  7. 2168203Species Leishmania major [TaxId:5664] [110590] (1 PDB entry)
    Uniprot P84066
  8. 2168205Domain d1tc5b1: 1tc5 B:10-194 [106753]
    Other proteins in same PDB: d1tc5a2, d1tc5b2, d1tc5c2, d1tc5d2
    Structural genomics target

Details for d1tc5b1

PDB Entry: 1tc5 (more details), 1.93 Å

PDB Description: structural analysis of a probable eukaryotic d-amino acid trna deacylase
PDB Compounds: (B:) Probable eukaryotic D-amino acid tRNA deacylase, LMAJ005534AAA

SCOPe Domain Sequences for d1tc5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tc5b1 c.110.1.1 (B:10-194) probable eukaryotic D-amino acid tRNA deacylase {Leishmania major [TaxId: 5664]}
tirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrhavgvllhtk
ifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakdvgaalydrf
chfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqglrfesegpft
hmfdi

SCOPe Domain Coordinates for d1tc5b1:

Click to download the PDB-style file with coordinates for d1tc5b1.
(The format of our PDB-style files is described here.)

Timeline for d1tc5b1: