SCOP 1.69: Domain d1tc5b_: 1tc5 B:

Lineage for d1tc5b_ (1tc5 B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.110: DTD-like (Pfam 02580) [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like (Pfam 02580) [69500] (1 family)
   active form is a dimer

5. Family c.110.1.1: DTD-like (Pfam 02580) [69501] (2 proteins)

6. Protein probable eukaryotic D-amino acid tRNA deacylase [110589] (1 species)

7. Species Leishmania major [TaxId:5664] [110590] (1 PDB entry)

8. Domain d1tc5b_: 1tc5 B: [106753]

Details for d1tc5b_

PDB Entry: 1tc5, 1.93 Å

PDB Description: structural analysis of a probable eukaryotic d-amino acid trna deacylase

SCOP Domain Sequences for d1tc5b_:

Sequence; same for both SEQRES and ATOM records:

>d1tc5b_ c.110.1.1 (B:) probable eukaryotic D-amino acid tRNA deacylase {Leishmania major}
hmtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrhavgvllh
tkifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakdvgaalyd
rfchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqglrfesegp
fthmfdi

Timeline for d1tc5b_:

• d1tc5b_ is new in SCOP 1.69
  
• d1tc5b_ appears in SCOP 1.71
  
• d1tc5b_ appears in the current release, SCOPe 2.08, called d1tc5b1