Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.48: F93-like [109674] (4 proteins) contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers |
Protein Hypothetical protein F93 [109675] (1 species) |
Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109676] (1 PDB entry) Uniprot P20222 |
Domain d1tbxb_: 1tbx B: [106749] Other proteins in same PDB: d1tbxa2 |
PDB Entry: 1tbx (more details), 2.7 Å
SCOPe Domain Sequences for d1tbxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbxb_ a.4.5.48 (B:) Hypothetical protein F93 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]} kstpffypeaivlaylydnegiatydlykkvnaefpmstatfydakkfliqegfvkerqe rgekrlyltekgklfaislktaietykqik
Timeline for d1tbxb_: