Lineage for d1tbxb_ (1tbx B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307618Family a.4.5.48: F93-like [109674] (4 proteins)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers
  6. 2307619Protein Hypothetical protein F93 [109675] (1 species)
  7. 2307620Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109676] (1 PDB entry)
    Uniprot P20222
  8. 2307622Domain d1tbxb_: 1tbx B: [106749]
    Other proteins in same PDB: d1tbxa2

Details for d1tbxb_

PDB Entry: 1tbx (more details), 2.7 Å

PDB Description: Crystal structure of SSV1 F-93
PDB Compounds: (B:) Hypothetical 11.0 kDa protein

SCOPe Domain Sequences for d1tbxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbxb_ a.4.5.48 (B:) Hypothetical protein F93 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]}
kstpffypeaivlaylydnegiatydlykkvnaefpmstatfydakkfliqegfvkerqe
rgekrlyltekgklfaislktaietykqik

SCOPe Domain Coordinates for d1tbxb_:

Click to download the PDB-style file with coordinates for d1tbxb_.
(The format of our PDB-style files is described here.)

Timeline for d1tbxb_: