SCOP 1.69: Domain d1tbxb_: 1tbx B:

Lineage for d1tbxb_ (1tbx B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.48: Hypothetical protein F93 [109674] (1 protein)
   contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers

6. Protein Hypothetical protein F93 [109675] (1 species)

7. Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109676] (1 PDB entry)

8. Domain d1tbxb_: 1tbx B: [106749]

Details for d1tbxb_

PDB Entry: 1tbx, 2.7 Å

PDB Description: Crystal structure of SSV1 F-93

SCOP Domain Sequences for d1tbxb_:

Sequence; same for both SEQRES and ATOM records:

>d1tbxb_ a.4.5.48 (B:) Hypothetical protein F93 {Sulfolobus virus-like particle SSV1}
kstpffypeaivlaylydnegiatydlykkvnaefpmstatfydakkfliqegfvkerqe
rgekrlyltekgklfaislktaietykqik

Timeline for d1tbxb_:

• d1tbxb_ is new in SCOP 1.69
  
• d1tbxb_ appears in SCOP 1.71
  
• d1tbxb_ appears in the current release, SCOPe 2.08