Lineage for d1tbxa1 (1tbx A:3-93)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694199Family a.4.5.48: F93-like [109674] (4 proteins)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers
  6. 2694200Protein Hypothetical protein F93 [109675] (1 species)
  7. 2694201Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109676] (1 PDB entry)
    Uniprot P20222
  8. 2694202Domain d1tbxa1: 1tbx A:3-93 [106748]
    Other proteins in same PDB: d1tbxa2

Details for d1tbxa1

PDB Entry: 1tbx (more details), 2.7 Å

PDB Description: Crystal structure of SSV1 F-93
PDB Compounds: (A:) Hypothetical 11.0 kDa protein

SCOPe Domain Sequences for d1tbxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbxa1 a.4.5.48 (A:3-93) Hypothetical protein F93 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]}
stpffypeaivlaylydnegiatydlykkvnaefpmstatfydakkfliqegfvkerqer
gekrlyltekgklfaislktaietykqikkr

SCOPe Domain Coordinates for d1tbxa1:

Click to download the PDB-style file with coordinates for d1tbxa1.
(The format of our PDB-style files is described here.)

Timeline for d1tbxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tbxa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tbxb_