Lineage for d1tbma_ (1tbm A:)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (3 families) 
Family a.211.1.2: PDEase [48548] (6 proteins)
Pfam 00233; multihelical; can be divided into three subdomains
Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (1 species) Species Human (Homo sapiens) [TaxId:9606] [109943] (1 PDB entry) 
Domain d1tbma_: 1tbm A: [106744]
Details for d1tbma_
PDB Entry: 1tbm (more details), 2.23 Å
PDB Description: Crystal structure of phosphodiesterase 9 shows orientation variation of inhibitor IBMX binding
SCOP Domain Sequences for d1tbma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbma_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens)}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk
SCOP Domain Coordinates for d1tbma_:
Click to download the PDB-style file with coordinates for d1tbma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tbma_:
- d1tbma_ first appeared in SCOP 1.69
- d1tbma_ does not appear in SCOP 1.73
View in 3D
