SCOPe 2.05: Domain d1tbbb_: 1tbb B:

Lineage for d1tbbb_ (1tbb B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (35 PDB entries)
   Uniprot Q08499 388-713

8. Domain d1tbbb_: 1tbb B: [106742]
   complexed with edo, mg, rol, zn

Details for d1tbbb_

PDB Entry: 1tbb, 1.6 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4D In Complex With Rolipram

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d1tbbb_:

Sequence; same for both SEQRES and ATOM records:

>d1tbbb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
eqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
ivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkpl
qlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwad
lvhpdaqdildtlednrewyqstipq

Timeline for d1tbbb_:

• d1tbbb_ first appeared in SCOP 1.69
  
• d1tbbb_ appears in SCOPe 2.04
  
• d1tbbb_ appears in SCOPe 2.06
  
• d1tbbb_ appears in the current release, SCOPe 2.08