SCOPe 2.07: Domain d1tb7b_: 1tb7 B:

Lineage for d1tb7b_ (1tb7 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (72 PDB entries)
   Uniprot Q08499 388-713

8. Domain d1tb7b_: 1tb7 B: [106740]
   complexed with amp, b3p, edo, mg, zn

Details for d1tb7b_

PDB Entry: 1tb7, 1.63 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4D In Complex With AMP

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d1tb7b_:

Sequence; same for both SEQRES and ATOM records:

>d1tb7b_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstip

Timeline for d1tb7b_:

• d1tb7b_ first appeared in SCOP 1.69
  
• d1tb7b_ appears in SCOPe 2.06
  
• d1tb7b_ appears in the current release, SCOPe 2.08