![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Thrombin [50531] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries) Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620 |
![]() | Domain d1tb6.1: 1tb6 L:,H: [106737] Other proteins in same PDB: d1tb6i_ complexed with mpd, ndg |
PDB Entry: 1tb6 (more details), 2.5 Å
SCOPe Domain Sequences for d1tb6.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1tb6.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]} seyqtffnprtfgsgeadcglrplfekksledkterellesyiXivegsdaeigmspwqv mlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryernie kismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykg rvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegk rgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidq fge
Timeline for d1tb6.1: