Lineage for d1tb6.1 (1tb6 L:,H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794031Protein Thrombin [50531] (2 species)
  7. 1794067Species Human (Homo sapiens) [TaxId:9606] [50532] (169 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 1794213Domain d1tb6.1: 1tb6 L:,H: [106737]
    Other proteins in same PDB: d1tb6i_
    complexed with mpd, ndg

Details for d1tb6.1

PDB Entry: 1tb6 (more details), 2.5 Å

PDB Description: 2.5a crystal structure of the antithrombin-thrombin-heparin ternary complex
PDB Compounds: (H:) thrombin, (L:) thrombin

SCOPe Domain Sequences for d1tb6.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1tb6.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
seyqtffnprtfgsgeadcglrplfekksledkterellesyiXivegsdaeigmspwqv
mlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryernie
kismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykg
rvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegk
rgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidq
fge

SCOPe Domain Coordinates for d1tb6.1:

Click to download the PDB-style file with coordinates for d1tb6.1.
(The format of our PDB-style files is described here.)

Timeline for d1tb6.1: