SCOPe 2.04: Domain d1tb6.1: 1tb6 L:,H:

Lineage for d1tb6.1 (1tb6 L:,H:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (169 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1tb6.1: 1tb6 L:,H: [106737]
   Other proteins in same PDB: d1tb6i_
   complexed with mpd, ndg

Details for d1tb6.1

PDB Entry: 1tb6, 2.5 Å

PDB Description: 2.5a crystal structure of the antithrombin-thrombin-heparin ternary complex

PDB Compounds: (H:) thrombin, (L:) thrombin

SCOPe Domain Sequences for d1tb6.1:

Sequence; same for both SEQRES and ATOM records:

>g1tb6.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
seyqtffnprtfgsgeadcglrplfekksledkterellesyiXivegsdaeigmspwqv
mlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryernie
kismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykg
rvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegk
rgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidq
fge

Timeline for d1tb6.1:

• d1tb6.1 first appeared in SCOP 1.69
  
• d1tb6.1 appears in SCOPe 2.03
  
• d1tb6.1 appears in SCOPe 2.05
  
• d1tb6.1 appears in the current release, SCOPe 2.08