![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (3 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (6 proteins) Pfam 00233; multihelical; can be divided into three subdomains |
![]() | Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries) |
![]() | Domain d1tb5b_: 1tb5 B: [106736] complexed with amp, mg, zn |
PDB Entry: 1tb5 (more details), 2.15 Å
SCOP Domain Sequences for d1tb5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tb5b_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens)} edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv qpdaqdildtlednrnwyqsmip
Timeline for d1tb5b_: