Lineage for d1tb5b_ (1tb5 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546038Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 546039Superfamily a.211.1: HD-domain/PDEase-like [109604] (3 families) (S)
  5. 546057Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam 00233; multihelical; can be divided into three subdomains
  6. 546061Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 546062Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries)
  8. 546080Domain d1tb5b_: 1tb5 B: [106736]
    complexed with amp, mg, zn

Details for d1tb5b_

PDB Entry: 1tb5 (more details), 2.15 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With AMP

SCOP Domain Sequences for d1tb5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tb5b_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens)}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

SCOP Domain Coordinates for d1tb5b_:

Click to download the PDB-style file with coordinates for d1tb5b_.
(The format of our PDB-style files is described here.)

Timeline for d1tb5b_: