Lineage for d1ta3b_ (1ta3 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831125Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2831141Species Emericella nidulans (Aspergillus nidulans) [TaxId:162425] [110350] (1 PDB entry)
    Uniprot Q00177
  8. 2831142Domain d1ta3b_: 1ta3 B: [106732]
    Other proteins in same PDB: d1ta3a_
    complexed with edo, nag

Details for d1ta3b_

PDB Entry: 1ta3 (more details), 1.7 Å

PDB Description: crystal structure of xylanase (gh10) in complex with inhibitor (xip)
PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1ta3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]}
aslndlfvaagksyfgtcsdqallqnsqneaivasqfgvitpensmkwdalepsqgnfgw
sgadylvdyatqhnkkvrghtlvwhsqlpswvssigdantlrsvmtnhinevvgrykgki
mhwdvvneifnedgtfrnsvfynllgedfvriafetaraadpdaklyindynldsasyak
tqamasyvkkwlaegvpidgigsqahyssshwssteaagalsslantgvsevaiteldia
gaassdylnllnaclneqkcvgitvwgvsdkdswrasdspllfdgnyqpkdaynaivnal
s

SCOPe Domain Coordinates for d1ta3b_:

Click to download the PDB-style file with coordinates for d1ta3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ta3b_: