Lineage for d1ta0a_ (1ta0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883706Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins)
    Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet;
  6. 1883707Protein Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 [110510] (1 species)
  7. 1883708Species Human (Homo sapiens) [TaxId:9606] [110511] (2 PDB entries)
    Uniprot Q9GZU7 76-256
  8. 1883709Domain d1ta0a_: 1ta0 A: [106729]
    complexed with cit, mg

Details for d1ta0a_

PDB Entry: 1ta0 (more details), 2.1 Å

PDB Description: Three-dimensional structure of a RNA-polymerase II binding protein with associated ligand.
PDB Compounds: (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1

SCOPe Domain Sequences for d1ta0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]}
mqyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphv
deflqrmgelfecvlftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrl
grdlrrvlildnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlr
q

SCOPe Domain Coordinates for d1ta0a_:

Click to download the PDB-style file with coordinates for d1ta0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ta0a_: