SCOPe 2.08: Domain d1ta0a1: 1ta0 A:77-256

Lineage for d1ta0a1 (1ta0 A:77-256)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins)
   Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet;

6. Protein Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 [110510] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110511] (2 PDB entries)
   Uniprot Q9GZU7 76-256

8. Domain d1ta0a1: 1ta0 A:77-256 [106729]
   Other proteins in same PDB: d1ta0a2
   complexed with cit, mg

Details for d1ta0a1

PDB Entry: 1ta0, 2.1 Å

PDB Description: Three-dimensional structure of a RNA-polymerase II binding protein with associated ligand.

PDB Compounds: (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1

SCOPe Domain Sequences for d1ta0a1:

Sequence; same for both SEQRES and ATOM records:

>d1ta0a1 c.108.1.16 (A:77-256) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]}
qyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphvd
eflqrmgelfecvlftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrlg
rdlrrvlildnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlrq

Timeline for d1ta0a1:

• d1ta0a1 first appeared in SCOP 1.69, called d1ta0a_
  
• d1ta0a1 appears in SCOPe 2.07