Lineage for d1ta0a1 (1ta0 A:77-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920127Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins)
    Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet;
  6. 2920128Protein Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 [110510] (1 species)
  7. 2920129Species Human (Homo sapiens) [TaxId:9606] [110511] (2 PDB entries)
    Uniprot Q9GZU7 76-256
  8. 2920130Domain d1ta0a1: 1ta0 A:77-256 [106729]
    Other proteins in same PDB: d1ta0a2
    complexed with cit, mg

Details for d1ta0a1

PDB Entry: 1ta0 (more details), 2.1 Å

PDB Description: Three-dimensional structure of a RNA-polymerase II binding protein with associated ligand.
PDB Compounds: (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1

SCOPe Domain Sequences for d1ta0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ta0a1 c.108.1.16 (A:77-256) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]}
qyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphvd
eflqrmgelfecvlftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrlg
rdlrrvlildnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlrq

SCOPe Domain Coordinates for d1ta0a1:

Click to download the PDB-style file with coordinates for d1ta0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ta0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ta0a2