Lineage for d1t9za_ (1t9z A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495850Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 495851Superfamily c.108.1: HAD-like [56784] (16 families) (S)
    contains an insert alpha+beta subdomain; similar overall fold to the Cof family
    usually contains an insertion (sub)domain after strand 1
  5. 496020Family c.108.1.16: NLI interacting factor-like phosphatase (NIF, Pfam 03031) [110509] (1 protein)
    the insertion subdomain is a 3-stranded beta-sheet;
  6. 496021Protein Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 [110510] (1 species)
  7. 496022Species Human (Homo sapiens) [TaxId:9606] [110511] (2 PDB entries)
  8. 496024Domain d1t9za_: 1t9z A: [106728]

Details for d1t9za_

PDB Entry: 1t9z (more details), 2.3 Å

PDB Description: three-dimensional structure of a rna-polymerase ii binding protein.

SCOP Domain Sequences for d1t9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9za_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens)}
mqyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphv
deflqrmgelfecvlftaslakyadpvadmldkwgafrarlfrescvfhrgnyvkdlsrl
grdlrrvlimdnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlr
q

SCOP Domain Coordinates for d1t9za_:

Click to download the PDB-style file with coordinates for d1t9za_.
(The format of our PDB-style files is described here.)

Timeline for d1t9za_: