![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (16 families) ![]() contains an insert alpha+beta subdomain; similar overall fold to the Cof family usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.16: NLI interacting factor-like phosphatase (NIF, Pfam 03031) [110509] (1 protein) the insertion subdomain is a 3-stranded beta-sheet; |
![]() | Protein Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 [110510] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110511] (2 PDB entries) |
![]() | Domain d1t9za_: 1t9z A: [106728] |
PDB Entry: 1t9z (more details), 2.3 Å
SCOP Domain Sequences for d1t9za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9za_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens)} mqyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphv deflqrmgelfecvlftaslakyadpvadmldkwgafrarlfrescvfhrgnyvkdlsrl grdlrrvlimdnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlr q
Timeline for d1t9za_: