Lineage for d1t9kd_ (1t9k D:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595310Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 595311Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 595419Family c.124.1.5: IF2B-like [110513] (4 proteins)
    Pfam 01008; contains extra N-terminal alpha+beta domain (1-126); beta(3)-alpha(5); 3 layers: b/a/a
  6. 595420Protein Probable methylthioribose-1-phosphate isomerase TM0911 [110514] (1 species)
  7. 595421Species Thermotoga maritima [TaxId:243274] [110515] (1 PDB entry)
  8. 595425Domain d1t9kd_: 1t9k D: [106724]
    Structural genomics target
    complexed with cl, so4

Details for d1t9kd_

PDB Entry: 1t9k (more details), 2.6 Å

PDB Description: x-ray crystal structure of aif-2b alpha subunit-related translation initiation factor [thermotoga maritima]

SCOP Domain Sequences for d1t9kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9kd_ c.124.1.5 (D:) Probable methylthioribose-1-phosphate isomerase TM0911 {Thermotoga maritima}
mklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafg
yvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilen
ealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesgkr
irvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrialng
dtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnria
pegvkvlnpafdvtentlitaiitekgvirppfeenikkile

SCOP Domain Coordinates for d1t9kd_:

Click to download the PDB-style file with coordinates for d1t9kd_.
(The format of our PDB-style files is described here.)

Timeline for d1t9kd_: