Lineage for d1t9kc_ (1t9k C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169412Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2169413Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2169624Family c.124.1.5: IF2B-like [110513] (5 proteins)
    Pfam PF01008; contains extra N-terminal alpha+beta domain (1-126); beta(3)-alpha(5); 3 layers: b/a/a
  6. 2169629Protein Probable methylthioribose-1-phosphate isomerase TM0911 [110514] (1 species)
  7. 2169630Species Thermotoga maritima [TaxId:2336] [110515] (1 PDB entry)
    Uniprot Q9X013
  8. 2169633Domain d1t9kc_: 1t9k C: [106723]
    Structural genomics target
    complexed with cl, so4

Details for d1t9kc_

PDB Entry: 1t9k (more details), 2.6 Å

PDB Description: x-ray crystal structure of aif-2b alpha subunit-related translation initiation factor [thermotoga maritima]
PDB Compounds: (C:) Probable methylthioribose-1-phosphate isomerase

SCOPe Domain Sequences for d1t9kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9kc_ c.124.1.5 (C:) Probable methylthioribose-1-phosphate isomerase TM0911 {Thermotoga maritima [TaxId: 2336]}
mklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafg
yvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilen
ealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesgkr
irvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrialng
dtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnria
pegvkvlnpafdvtentlitaiitekgvirppfeenikkile

SCOPe Domain Coordinates for d1t9kc_:

Click to download the PDB-style file with coordinates for d1t9kc_.
(The format of our PDB-style files is described here.)

Timeline for d1t9kc_: