SCOP 1.69: Domain d1t9kc_: 1t9k C:

Lineage for d1t9kc_ (1t9k C:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families)

5. Family c.124.1.5: IF2B-like (Pfam 01008) [110513] (3 proteins)

6. Protein Probable methylthioribose-1-phosphate isomerase TM0911 [110514] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [110515] (1 PDB entry)

8. Domain d1t9kc_: 1t9k C: [106723]

Details for d1t9kc_

PDB Entry: 1t9k, 2.6 Å

PDB Description: x-ray crystal structure of aif-2b alpha subunit-related translation initiation factor [thermotoga maritima]

SCOP Domain Sequences for d1t9kc_:

Sequence; same for both SEQRES and ATOM records:

>d1t9kc_ c.124.1.5 (C:) Probable methylthioribose-1-phosphate isomerase TM0911 {Thermotoga maritima}
mklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafg
yvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilen
ealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesgkr
irvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrialng
dtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnria
pegvkvlnpafdvtentlitaiitekgvirppfeenikkile

Timeline for d1t9kc_:

• d1t9kc_ is new in SCOP 1.69
  
• d1t9kc_ appears in SCOP 1.71
  
• d1t9kc_ appears in the current release, SCOPe 2.08