Lineage for d1t9kc_ (1t9k C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496441Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 496442Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 496544Family c.124.1.5: IF2B-like (Pfam 01008) [110513] (3 proteins)
  6. 496545Protein Probable methylthioribose-1-phosphate isomerase TM0911 [110514] (1 species)
  7. 496546Species Thermotoga maritima [TaxId:243274] [110515] (1 PDB entry)
  8. 496549Domain d1t9kc_: 1t9k C: [106723]

Details for d1t9kc_

PDB Entry: 1t9k (more details), 2.6 Å

PDB Description: x-ray crystal structure of aif-2b alpha subunit-related translation initiation factor [thermotoga maritima]

SCOP Domain Sequences for d1t9kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9kc_ c.124.1.5 (C:) Probable methylthioribose-1-phosphate isomerase TM0911 {Thermotoga maritima}
mklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafg
yvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilen
ealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesgkr
irvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrialng
dtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnria
pegvkvlnpafdvtentlitaiitekgvirppfeenikkile

SCOP Domain Coordinates for d1t9kc_:

Click to download the PDB-style file with coordinates for d1t9kc_.
(The format of our PDB-style files is described here.)

Timeline for d1t9kc_: