Lineage for d1t9gs_ (1t9g S:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469682Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 2469704Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 2469705Species Human (Homo sapiens) [TaxId:9606] [81390] (3 PDB entries)
    Uniprot P38117
  8. 2469708Domain d1t9gs_: 1t9g S: [106720]
    Other proteins in same PDB: d1t9ga1, d1t9ga2, d1t9gb1, d1t9gb2, d1t9gc1, d1t9gc2, d1t9gd1, d1t9gd2, d1t9gr_
    complexed with amp, fad

Details for d1t9gs_

PDB Entry: 1t9g (more details), 2.9 Å

PDB Description: Structure of the human MCAD:ETF complex
PDB Compounds: (S:) Electron transfer flavoprotein beta-subunit

SCOPe Domain Sequences for d1t9gs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9gs_ c.26.2.3 (S:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]}
lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpavvta
dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedpp

SCOPe Domain Coordinates for d1t9gs_:

Click to download the PDB-style file with coordinates for d1t9gs_.
(The format of our PDB-style files is described here.)

Timeline for d1t9gs_: