![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.3: ETFP subunits [52432] (2 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
![]() | Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species) binds AMP |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81390] (4 PDB entries) |
![]() | Domain d1t9gs_: 1t9g S: [106720] Other proteins in same PDB: d1t9ga1, d1t9ga2, d1t9gb1, d1t9gb2, d1t9gc1, d1t9gc2, d1t9gd1, d1t9gd2, d1t9gr_ complexed with amp, fad |
PDB Entry: 1t9g (more details), 2.9 Å
SCOP Domain Sequences for d1t9gs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9gs_ c.26.2.3 (S:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpavvta dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedpp
Timeline for d1t9gs_: