Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species) contains an additional FAD-binding domain of DHS-like fold |
Species Human (Homo sapiens) [TaxId:9606] [81389] (4 PDB entries) Uniprot P13804 20-203 |
Domain d1t9gr_: 1t9g R: [106719] Other proteins in same PDB: d1t9ga1, d1t9ga2, d1t9gb1, d1t9gb2, d1t9gc1, d1t9gc2, d1t9gd1, d1t9gd2, d1t9gs_ only the N-terminal domain is ordered in the crystal complexed with amp, fad |
PDB Entry: 1t9g (more details), 2.9 Å
SCOPe Domain Sequences for d1t9gr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9gr_ c.26.2.3 (R:) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew ldqk
Timeline for d1t9gr_: