![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (6 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (7 proteins) |
![]() | Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47209] (4 PDB entries) |
![]() | Domain d1t9gd1: 1t9g D:242-395 [106717] Other proteins in same PDB: d1t9ga2, d1t9gb2, d1t9gc2, d1t9gd2, d1t9gr_, d1t9gs_ complexed with amp, fad |
PDB Entry: 1t9g (more details), 2.9 Å
SCOP Domain Sequences for d1t9gd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9gd1 a.29.3.1 (D:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens)} gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp veklmrdakiyqiyegtsqiqrlivarehidkyk
Timeline for d1t9gd1: