Lineage for d1t9gd1 (1t9g D:242-395)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442020Fold a.29: Bromodomain-like [47363] (6 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 442039Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 442040Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (6 proteins)
  6. 442064Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (2 species)
  7. 442065Species Human (Homo sapiens) [TaxId:9606] [47209] (4 PDB entries)
  8. 442077Domain d1t9gd1: 1t9g D:242-395 [106717]
    Other proteins in same PDB: d1t9ga2, d1t9gb2, d1t9gc2, d1t9gd2, d1t9gr_, d1t9gs_

Details for d1t9gd1

PDB Entry: 1t9g (more details), 2.9 Å

PDB Description: Structure of the human MCAD:ETF complex

SCOP Domain Sequences for d1t9gd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9gd1 a.29.3.1 (D:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens)}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkyk

SCOP Domain Coordinates for d1t9gd1:

Click to download the PDB-style file with coordinates for d1t9gd1.
(The format of our PDB-style files is described here.)

Timeline for d1t9gd1: