Lineage for d1t9ga1 (1t9g A:242-395)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2321545Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2321546Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2321587Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
  7. 2321588Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries)
    Uniprot P11310 34-421
  8. 2321605Domain d1t9ga1: 1t9g A:242-395 [106711]
    Other proteins in same PDB: d1t9ga2, d1t9gb2, d1t9gc2, d1t9gd2, d1t9gr_, d1t9gs_
    complexed with amp, fad

Details for d1t9ga1

PDB Entry: 1t9g (more details), 2.9 Å

PDB Description: Structure of the human MCAD:ETF complex
PDB Compounds: (A:) Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial

SCOPe Domain Sequences for d1t9ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9ga1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkyk

SCOPe Domain Coordinates for d1t9ga1:

Click to download the PDB-style file with coordinates for d1t9ga1.
(The format of our PDB-style files is described here.)

Timeline for d1t9ga1: