SCOPe 2.06: Domain d1t9fa1: 1t9f A:22-197

Lineage for d1t9fa1 (1t9f A:22-197)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.6: MIR domain [82109] (3 families)

5. Family b.42.6.1: MIR domain [82110] (2 proteins)
   Pfam PF02815

6. Protein Hypothetical protein R12E2.13 (1D10) [110205] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110206] (1 PDB entry)
   Uniprot O61793

8. Domain d1t9fa1: 1t9f A:22-197 [106710]
   Other proteins in same PDB: d1t9fa2
   Structural genomics target
   complexed with mli

Details for d1t9fa1

PDB Entry: 1t9f, 2 Å

PDB Description: Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function

PDB Compounds: (A:) protein 1d10

SCOPe Domain Sequences for d1t9fa1:

Sequence; same for both SEQRES and ATOM records:

>d1t9fa1 b.42.6.1 (A:22-197) Hypothetical protein R12E2.13 (1D10) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dedfvtcysvlkfinandgsrlhshdvkygsgsgqqsvtavknsddinshwqifpalnak
cnrgdaikcgdkirlkhlttgtflhshhftaplskqhqevsafgseaesdtgddwtvicn
gdewleseqfklrhavtgsylslsgqqfgrpihgqrevvgtdsitggsawkvaegi

Timeline for d1t9fa1:

• d1t9fa1 first appeared in SCOP 1.69, called d1t9fa_
  
• d1t9fa1 was called d1t9fa_ in SCOPe 2.05
  
• d1t9fa1 appears in SCOPe 2.07
  
• d1t9fa1 appears in the current release, SCOPe 2.08