Lineage for d1t9fa_ (1t9f A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.6: MIR domain (Pfam 02815) [82109] (1 family) 
Family b.42.6.1: MIR domain (Pfam 02815) [82110] (2 proteins) Protein Hypothetical protein R12E2.13 (1D10) [110205] (1 species) Species Caenorhabditis elegans [110206] (1 PDB entry) 
Domain d1t9fa_: 1t9f A: [106710]
Structural genomics target
Details for d1t9fa_
PDB Entry: 1t9f (more details), 2 Å
PDB Description: Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function
SCOP Domain Sequences for d1t9fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9fa_ b.42.6.1 (A:) Hypothetical protein R12E2.13 (1D10) {Caenorhabditis elegans}
gsdedfvtcysvlkfinandgsrlhshdvkygsgsgqqsvtavknsddinshwqifpaln
akcnrgdaikcgdkirlkhlttgtflhshhftaplskqhqevsafgseaesdtgddwtvi
cngdewleseqfklrhavtgsylslsgqqfgrpihgqrevvgtdsitggsawkvaegi
SCOP Domain Coordinates for d1t9fa_:
Click to download the PDB-style file with coordinates for d1t9fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t9fa_:
- d1t9fa_ is new in SCOP 1.69
- d1t9fa_ appears in SCOP 1.71
- d1t9fa_ appears in the current release, SCOPe 2.08, called d1t9fa1
View in 3D