Lineage for d1t95a2 (1t95 A:11-86)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008360Fold d.235: FYSH domain [89894] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234
  4. 3008361Superfamily d.235.1: FYSH domain [89895] (3 families) (S)
  5. 3008366Family d.235.1.2: Hypothetical protein AF0491, N-terminal domain [110893] (1 protein)
    automatically mapped to Pfam PF01172
  6. 3008367Protein Hypothetical protein AF0491, N-terminal domain [110894] (1 species)
  7. 3008368Species Archaeoglobus fulgidus [TaxId:2234] [110895] (2 PDB entries)
    Uniprot O29759
  8. 3008369Domain d1t95a2: 1t95 A:11-86 [106706]
    Other proteins in same PDB: d1t95a1, d1t95a3

Details for d1t95a2

PDB Entry: 1t95 (more details), 1.9 Å

PDB Description: Crystal Structure of the Shwachman-Bodian-Diamond Syndrome Protein Orthologue from Archaeoglobus fulgidus
PDB Compounds: (A:) Hypothetical protein AF0491

SCOPe Domain Sequences for d1t95a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t95a2 d.235.1.2 (A:11-86) Hypothetical protein AF0491, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
dkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvdelr
kifgtddvfeiarkii

SCOPe Domain Coordinates for d1t95a2:

Click to download the PDB-style file with coordinates for d1t95a2.
(The format of our PDB-style files is described here.)

Timeline for d1t95a2: