SCOPe 2.06: Domain d1t95a1: 1t95 A:87-161

Lineage for d1t95a1 (1t95 A:87-161)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.8: Hypothetical protein AF0491, middle domain [109728] (2 families)

5. Family a.5.8.1: Hypothetical protein AF0491, middle domain [109729] (1 protein)

6. Protein Hypothetical protein AF0491, middle domain [109730] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [109731] (2 PDB entries)
   Uniprot O29759

8. Domain d1t95a1: 1t95 A:87-161 [106705]
   Other proteins in same PDB: d1t95a2, d1t95a3

Details for d1t95a1

PDB Entry: 1t95, 1.9 Å

PDB Description: Crystal Structure of the Shwachman-Bodian-Diamond Syndrome Protein Orthologue from Archaeoglobus fulgidus

PDB Compounds: (A:) Hypothetical protein AF0491

SCOPe Domain Sequences for d1t95a1:

Sequence; same for both SEQRES and ATOM records:

>d1t95a1 a.5.8.1 (A:87-161) Hypothetical protein AF0491, middle domain {Archaeoglobus fulgidus [TaxId: 2234]}
legevqitaeqrremleakrkqiinfisrntidprtnaphppsrieraleeakvhidifk
sveaqvkdivkalkp

Timeline for d1t95a1:

• d1t95a1 first appeared in SCOP 1.69
  
• d1t95a1 appears in SCOPe 2.05
  
• d1t95a1 appears in SCOPe 2.07
  
• d1t95a1 appears in the current release, SCOPe 2.08