Lineage for d1t95a1 (1t95 A:87-161)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696323Superfamily a.5.8: Hypothetical protein AF0491, middle domain [109728] (2 families) (S)
  5. 2696324Family a.5.8.1: Hypothetical protein AF0491, middle domain [109729] (1 protein)
  6. 2696325Protein Hypothetical protein AF0491, middle domain [109730] (1 species)
  7. 2696326Species Archaeoglobus fulgidus [TaxId:2234] [109731] (2 PDB entries)
    Uniprot O29759
  8. 2696327Domain d1t95a1: 1t95 A:87-161 [106705]
    Other proteins in same PDB: d1t95a2, d1t95a3

Details for d1t95a1

PDB Entry: 1t95 (more details), 1.9 Å

PDB Description: Crystal Structure of the Shwachman-Bodian-Diamond Syndrome Protein Orthologue from Archaeoglobus fulgidus
PDB Compounds: (A:) Hypothetical protein AF0491

SCOPe Domain Sequences for d1t95a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t95a1 a.5.8.1 (A:87-161) Hypothetical protein AF0491, middle domain {Archaeoglobus fulgidus [TaxId: 2234]}
legevqitaeqrremleakrkqiinfisrntidprtnaphppsrieraleeakvhidifk
sveaqvkdivkalkp

SCOPe Domain Coordinates for d1t95a1:

Click to download the PDB-style file with coordinates for d1t95a1.
(The format of our PDB-style files is described here.)

Timeline for d1t95a1: