Lineage for d1t94b1 (1t94 B:413-515)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008408Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 3008503Protein DNA polymerase kappa [111017] (1 species)
  7. 3008504Species Human (Homo sapiens) [TaxId:9606] [111018] (1 PDB entry)
    Uniprot Q9UBT6 71-517
  8. 3008506Domain d1t94b1: 1t94 B:413-515 [106703]
    Other proteins in same PDB: d1t94a2, d1t94b2

Details for d1t94b1

PDB Entry: 1t94 (more details), 2.4 Å

PDB Description: crystal structure of the catalytic core of human dna polymerase kappa
PDB Compounds: (B:) polymerase (DNA directed) kappa

SCOPe Domain Sequences for d1t94b1:

Sequence, based on SEQRES records: (download)

>d1t94b1 d.240.1.1 (B:413-515) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]}
rksmsvertfseinkaeeqyslcqelcselaqdlqkerlkgrtvtiklknvnfevktras
tvssvvstaeeifaiakellkteidadfphplrlrlmgvriss

Sequence, based on observed residues (ATOM records): (download)

>d1t94b1 d.240.1.1 (B:413-515) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]}
rksmsvertfseinkaeeqyslcqelcselaqdlqkerlkgrtvtiklknvnfevktras
tsvvstaeeifaiakellkteidadfphplrlrlmgvriss

SCOPe Domain Coordinates for d1t94b1:

Click to download the PDB-style file with coordinates for d1t94b1.
(The format of our PDB-style files is described here.)

Timeline for d1t94b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t94b2