Lineage for d1t94a2 (1t94 A:75-407)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572686Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 2572787Protein DNA polymerase kappa [111297] (1 species)
  7. 2572788Species Human (Homo sapiens) [TaxId:9606] [111298] (1 PDB entry)
    Uniprot Q9UBT6 71-517
  8. 2572789Domain d1t94a2: 1t94 A:75-407 [106702]
    Other proteins in same PDB: d1t94a1, d1t94b1

Details for d1t94a2

PDB Entry: 1t94 (more details), 2.4 Å

PDB Description: crystal structure of the catalytic core of human dna polymerase kappa
PDB Compounds: (A:) polymerase (DNA directed) kappa

SCOPe Domain Sequences for d1t94a2:

Sequence, based on SEQRES records: (download)

>d1t94a2 e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]}
tsqqlrkaqlqvdrfameleqsrnlsntivhidmdafyaavemrdnpelkdkpiavgsms
mlstsnyharrfgvraampgfiakrlcpqliivppnfdkyravskevkeiladydpnfma
msldeaylnitkhleerqnwpedkrryfikmgssvendnpgkevnklsehersispllfe
espsdvqppgdpfqvnfeeqnnpqilqnsvvfgtsaqevvkeirfrieqkttltasagia
pntmlakvcsdknkpngqyqilpnrqavmdfikdlpirkvsgigkvtekmlkalgiitct
elyqqrallsllfsetswhyflhislglgsthl

Sequence, based on observed residues (ATOM records): (download)

>d1t94a2 e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]}
tsqqlrkaqlqvdrfameleqsrnlsntivhidmdafyaavemrdnpelkdkpiavgsms
mlstsnyharrfgvraampgfiakrlcpqliivppnfdkyravskevkeiladydpnfma
msldeaylnitkhleerqnwpedkrryfikmvendnpgkevnklsehersispllfnpqi
lqnsvvfgtsaqevvkeirfrieqkttltasagiapntmlakvcsdknkpngqyqilpnr
qavmdfikdlpirkvsgigkvtekmlkalgiitctelyqqrallsllfsetswhyflhis
lglgsthl

SCOPe Domain Coordinates for d1t94a2:

Click to download the PDB-style file with coordinates for d1t94a2.
(The format of our PDB-style files is described here.)

Timeline for d1t94a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t94a1