Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein DNA polymerase kappa [111297] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111298] (1 PDB entry) Uniprot Q9UBT6 71-517 |
Domain d1t94a2: 1t94 A:75-407 [106702] Other proteins in same PDB: d1t94a1, d1t94b1 |
PDB Entry: 1t94 (more details), 2.4 Å
SCOPe Domain Sequences for d1t94a2:
Sequence, based on SEQRES records: (download)
>d1t94a2 e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]} tsqqlrkaqlqvdrfameleqsrnlsntivhidmdafyaavemrdnpelkdkpiavgsms mlstsnyharrfgvraampgfiakrlcpqliivppnfdkyravskevkeiladydpnfma msldeaylnitkhleerqnwpedkrryfikmgssvendnpgkevnklsehersispllfe espsdvqppgdpfqvnfeeqnnpqilqnsvvfgtsaqevvkeirfrieqkttltasagia pntmlakvcsdknkpngqyqilpnrqavmdfikdlpirkvsgigkvtekmlkalgiitct elyqqrallsllfsetswhyflhislglgsthl
>d1t94a2 e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]} tsqqlrkaqlqvdrfameleqsrnlsntivhidmdafyaavemrdnpelkdkpiavgsms mlstsnyharrfgvraampgfiakrlcpqliivppnfdkyravskevkeiladydpnfma msldeaylnitkhleerqnwpedkrryfikmvendnpgkevnklsehersispllfnpqi lqnsvvfgtsaqevvkeirfrieqkttltasagiapntmlakvcsdknkpngqyqilpnr qavmdfikdlpirkvsgigkvtekmlkalgiitctelyqqrallsllfsetswhyflhis lglgsthl
Timeline for d1t94a2: