SCOP 1.71: Domain d1t8qd_: 1t8q D:

Lineage for d1t8qd_ (1t8q D:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families)

5. Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (2 proteins)
   Pfam 03009

6. Protein Glycerophosphodiester phosphodiesterase GlpQ [110382] (1 species)

7. Species Escherichia coli [TaxId:562] [110383] (1 PDB entry)

8. Domain d1t8qd_: 1t8q D: [106672]
   Structural genomics target
   complexed with gol, mg

Details for d1t8qd_

PDB Entry: 1t8q, 2 Å

PDB Description: Structural genomics, Crystal structure of Glycerophosphoryl diester phosphodiesterase from E. coli

SCOP Domain Sequences for d1t8qd_:

Sequence; same for both SEQRES and ATOM records:

>d1t8qd_ c.1.18.3 (D:) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli}
ekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdva
drfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtfe
eeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylqc
fdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamkq
vaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvnq
lydalynkagvnglftdfpdkavkfln

Timeline for d1t8qd_:

• d1t8qd_ first appeared in SCOP 1.69
  
• d1t8qd_ appears in SCOP 1.73
  
• d1t8qd_ appears in the current release, SCOPe 2.08