Lineage for d1t8qc_ (1t8q C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101609Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2101665Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins)
    Pfam PF03009
  6. 2101666Protein Glycerophosphodiester phosphodiesterase GlpQ [110382] (1 species)
  7. 2101667Species Escherichia coli [TaxId:562] [110383] (2 PDB entries)
    Uniprot P09394
  8. 2101672Domain d1t8qc_: 1t8q C: [106671]
    Structural genomics target
    complexed with gol, mg

Details for d1t8qc_

PDB Entry: 1t8q (more details), 2 Å

PDB Description: Structural genomics, Crystal structure of Glycerophosphoryl diester phosphodiesterase from E. coli
PDB Compounds: (C:) Glycerophosphoryl diester phosphodiesterase, periplasmic

SCOPe Domain Sequences for d1t8qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8qc_ c.1.18.3 (C:) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli [TaxId: 562]}
nekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdv
adrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtf
eeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylq
cfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamk
qvaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvn
qlydalynkagvnglftdfpdkavkfln

SCOPe Domain Coordinates for d1t8qc_:

Click to download the PDB-style file with coordinates for d1t8qc_.
(The format of our PDB-style files is described here.)

Timeline for d1t8qc_: