Lineage for d1t8qb_ (1t8q B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089342Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2089398Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 protein domains)
    Pfam PF03009
  6. 2089399Protein Glycerophosphodiester phosphodiesterase GlpQ [110382] (1 species)
  7. 2089400Species Escherichia coli [TaxId:562] [110383] (2 PDB entries)
    Uniprot P09394
  8. 2089404Domain d1t8qb_: 1t8q B: [106670]
    Structural genomics target
    complexed with gol, mg

Details for d1t8qb_

PDB Entry: 1t8q (more details), 2 Å

PDB Description: Structural genomics, Crystal structure of Glycerophosphoryl diester phosphodiesterase from E. coli
PDB Compounds: (B:) Glycerophosphoryl diester phosphodiesterase, periplasmic

SCOPe Domain Sequences for d1t8qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8qb_ c.1.18.3 (B:) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli [TaxId: 562]}
nekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdv
adrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtf
eeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylq
cfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamk
qvaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvn
qlydalynkagvnglftdfpdkavkflnk

SCOPe Domain Coordinates for d1t8qb_:

Click to download the PDB-style file with coordinates for d1t8qb_.
(The format of our PDB-style files is described here.)

Timeline for d1t8qb_: