Lineage for d1t8qa_ (1t8q A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476581Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) (S)
  5. 476620Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (2 proteins)
    Pfam 03009
  6. 476621Protein Glycerophosphodiester phosphodiesterase GlpQ [110382] (1 species)
  7. 476622Species Escherichia coli [TaxId:562] [110383] (1 PDB entry)
  8. 476623Domain d1t8qa_: 1t8q A: [106669]

Details for d1t8qa_

PDB Entry: 1t8q (more details), 2 Å

PDB Description: Structural genomics, Crystal structure of Glycerophosphoryl diester phosphodiesterase from E. coli

SCOP Domain Sequences for d1t8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8qa_ c.1.18.3 (A:) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli}
nekiviahrgasgylpehtlpakamayaqgadyleqdlvmtkddnlvvlhdhyldrvtdv
adrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpmgksdfrvhtf
eeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvylq
cfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamk
qvaeyadgigpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvn
qlydalynkagvnglftdfpdkavkfln

SCOP Domain Coordinates for d1t8qa_:

Click to download the PDB-style file with coordinates for d1t8qa_.
(The format of our PDB-style files is described here.)

Timeline for d1t8qa_: