Lineage for d1t8pb_ (1t8p B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489762Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 489763Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 489764Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins)
  6. 489770Protein Phosphoglycerate mutase [53256] (4 species)
  7. 489798Species Human (Homo sapiens) [TaxId:9606] [110656] (1 PDB entry)
  8. 489800Domain d1t8pb_: 1t8p B: [106668]

Details for d1t8pb_

PDB Entry: 1t8p (more details), 2.5 Å

PDB Description: Crystal structure of Human erythrocyte 2,3-bisphosphoglycerate mutase

SCOP Domain Sequences for d1t8pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8pb_ c.60.1.1 (B:) Phosphoglycerate mutase {Human (Homo sapiens)}
skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
qaaikkved

SCOP Domain Coordinates for d1t8pb_:

Click to download the PDB-style file with coordinates for d1t8pb_.
(The format of our PDB-style files is described here.)

Timeline for d1t8pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t8pa_