![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) ![]() |
![]() | Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins) |
![]() | Protein Phosphoglycerate mutase [53256] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110656] (1 PDB entry) |
![]() | Domain d1t8pa_: 1t8p A: [106667] |
PDB Entry: 1t8p (more details), 2.5 Å
SCOP Domain Sequences for d1t8pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t8pa_ c.60.1.1 (A:) Phosphoglycerate mutase {Human (Homo sapiens)} skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai qaaikkved
Timeline for d1t8pa_: