Lineage for d1t8ka_ (1t8k A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706115Protein Acyl carrier protein [47338] (7 species)
  7. 2706121Species Escherichia coli [TaxId:562] [47339] (26 PDB entries)
    Uniprot P02901
  8. 2706122Domain d1t8ka_: 1t8k A: [106666]
    complexed with imd, zn

Details for d1t8ka_

PDB Entry: 1t8k (more details), 1.1 Å

PDB Description: Crystal Structure of apo acyl carrier protein from E. coli
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d1t8ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

SCOPe Domain Coordinates for d1t8ka_:

Click to download the PDB-style file with coordinates for d1t8ka_.
(The format of our PDB-style files is described here.)

Timeline for d1t8ka_: