Lineage for d1t8ha_ (1t8h A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005836Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets
  4. 3005837Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families) (S)
  5. 3005846Family d.194.1.2: YfiH-like [111238] (5 proteins)
    Pfam PF02578; COG1496
  6. 3005864Protein Hypothetical protein YlmD [111239] (1 species)
  7. 3005865Species Bacillus stearothermophilus [TaxId:1422] [111240] (1 PDB entry)
    Uniprot P84138
  8. 3005866Domain d1t8ha_: 1t8h A: [106664]
    Structural genomics target
    complexed with bme, zn

Details for d1t8ha_

PDB Entry: 1t8h (more details), 1.8 Å

PDB Description: 1.8 a crystal structure of an uncharacterized b. stearothermophilus protein
PDB Compounds: (A:) YlmD protein sequence homologue

SCOPe Domain Sequences for d1t8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8ha_ d.194.1.2 (A:) Hypothetical protein YlmD {Bacillus stearothermophilus [TaxId: 1422]}
mpdifqqeargwlrcgappfagavaglttkhggeskgpfaslnmglhvgddrtdvvnnrr
rlaewlafplerwvcceqvhgadiqkvtksdrgngaqdfatavpgvdglytdeagvllal
cfadcvpiyfvapsaglvglahagwrgtaggiaghmvwlwqtrehiapsdiyvaigpaig
pccytvddrvvdslrptlppesplpwretspgqyaldlkeanrlqllaagvpnshiyvse
rctsceealffshrrdrgttgrmlafigrree

SCOPe Domain Coordinates for d1t8ha_:

Click to download the PDB-style file with coordinates for d1t8ha_.
(The format of our PDB-style files is described here.)

Timeline for d1t8ha_: