Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets |
Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families) |
Family d.194.1.2: YfiH-like [111238] (5 proteins) Pfam PF02578; COG1496 |
Protein Hypothetical protein YlmD [111239] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [111240] (1 PDB entry) Uniprot P84138 |
Domain d1t8ha_: 1t8h A: [106664] Structural genomics target complexed with bme, zn |
PDB Entry: 1t8h (more details), 1.8 Å
SCOPe Domain Sequences for d1t8ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t8ha_ d.194.1.2 (A:) Hypothetical protein YlmD {Bacillus stearothermophilus [TaxId: 1422]} mpdifqqeargwlrcgappfagavaglttkhggeskgpfaslnmglhvgddrtdvvnnrr rlaewlafplerwvcceqvhgadiqkvtksdrgngaqdfatavpgvdglytdeagvllal cfadcvpiyfvapsaglvglahagwrgtaggiaghmvwlwqtrehiapsdiyvaigpaig pccytvddrvvdslrptlppesplpwretspgqyaldlkeanrlqllaagvpnshiyvse rctsceealffshrrdrgttgrmlafigrree
Timeline for d1t8ha_: